PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Vang06g16250.1
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; fabids; Fabales; Fabaceae; Papilionoideae; Phaseoleae; Vigna
Family MYB_related
Protein Properties Length: 96aa    MW: 10711.3 Da    PI: 10.0538
Description MYB_related family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Vang06g16250.1genomeSNUView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1Myb_DNA-binding55.41.4e-171461148
                     TSSS-HHHHHHHHHHHHHTTTT-HHHHHHHHTTTS-HHHHHHHHHHHT CS
  Myb_DNA-binding  1 rgrWTteEdellvdavkqlGggtWktIartmgkgRtlkqcksrwqkyl 48
                     +grWT eEde+l+++++  G g+W++ ++  g+ R++k+c++rw +yl
   Vang06g16250.1 14 KGRWTSEEDEILAKYIQANGEGSWRSLPKNAGLLRCGKSCRLRWINYL 61
                     79******************************99************97 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
Gene3DG3DSA:1.10.10.606.6E-23564IPR009057Homeodomain-like
PROSITE profilePS5129420.753965IPR017930Myb domain
SMARTSM007171.9E-111363IPR001005SANT/Myb domain
PfamPF002491.3E-151461IPR001005SANT/Myb domain
SuperFamilySSF466891.01E-201588IPR009057Homeodomain-like
CDDcd001673.56E-91661No hitNo description
Gene3DG3DSA:1.10.10.601.8E-66588IPR009057Homeodomain-like
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0003677Molecular FunctionDNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 96 aa     Download sequence    Send to blast
MGRAPCCEKV GLKKGRWTSE EDEILAKYIQ ANGEGSWRSL PKNAGLLRCG KSCRLRWINY  60
LRADLKRGNI SAQEENTIVK LHASLGNRSA PLYYT*
Binding Motif ? help Back to Top
Motif ID Method Source Motif file
MP00668SELEXTransfer from GRMZM2G016020Download
Motif logo
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieveRetrieve
Annotation -- Nucleotide ? help Back to Top
Source Hit ID E-value Description
GenBankBT0934636e-94BT093463.1 Soybean clone JCVI-FLGm-17G16 unknown mRNA.
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_006574536.13e-55PREDICTED: transcription factor MYB12-like
RefseqXP_008350120.12e-55PREDICTED: myb-related protein P-like
SwissprotO222643e-49MYB12_ARATH; Transcription factor MYB12
SwissprotP278983e-49MYBP_MAIZE; Myb-related protein P
TrEMBLA0A0L9TWH05e-57A0A0L9TWH0_PHAAN; Uncharacterized protein
TrEMBLA0A0S3SSH35e-57A0A0S3SSH3_PHAAN; Uncharacterized protein
STRINGGLYMA02G01740.18e-55(Glycine max)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
FabidsOGEF3134817
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT5G49330.13e-51myb domain protein 111